Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBR2 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to TGF beta Receptor 2

Product Specifications

Product Name Alternative

Anti-AAT3 antibody, anti-FAA3 antibody, anti-LDS1B antibody, anti-LDS2 antibody, anti-LDS2B antibody, anti-MFS2 antibody, anti-RIIC antibody, anti-TAAD2 antibody, anti-TbetaR II antibody, anti-TbetaR-II antibody, anti-TGF beta receptor type 2 antibody, anti-TGF beta receptor type IIB antibody, anti-TGF beta type II receptor antibody, anti-TGF-beta receptor type II antibody, anti-TGF-beta receptor type-2 antibody, anti-TGF-beta type II receptor antibody, anti-TGF-beta-R2 antibody, anti-TGFB R2 antibody, anti-TGFbeta - RII antibody, anti-TGFbeta RII antibody, anti-Tgfbr2 antibody, anti-TGFR-2 antibody, anti-TGFR2_HUMAN antibody, anti-HNPCC6 antibody, anti-TGF-beta receptor type IIB antibody, anti-TGFbeta-RII antibody, anti-transforming growth factor beta receptor type IIC antibody, anti-Transforming growth factor-beta receptor type II antibody

UniProt

P37173

Reactivity

Human, Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TGFBR2

Target

TGFBR2

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Field of Research

Cell Biology

Purification

Protein A purified

Concentration

1.0 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

65 kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003233

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108191-01 0.1 mL

HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108191-02 0.2 mL

HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108191-03 0.5 mL

HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108191-04 1 mL

HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108191-05 5 mL

HRP-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details
RNF14 Recombinant Protein (Human)
RP042943 100 µg

RNF14 Recombinant Protein (Human)

Sign In for Pricing
View Details