Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinidia deliciosa Actinidain

Product Specifications

Product Name Alternative

Actinidin; Allergen Act d 1; allergen Act d 1

Abbreviation

Recombinant Actinidia deliciosa Actinidain protein

UniProt

A5HII1

Expression Region

127-380aa

Organism

Actinidia deliciosa (Kiwi)

Target Sequence

LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKHYSSGIFTGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHPKPYSSLINPPAFSMSKDGPVGVDDGQRYSA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cysteine protease responsible for the cleavage of kiwellin into kissper and KiTH.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hieff NGS™ RNA Lib Prep Primer Mix for MGI
13334ES24 24 Tests

Hieff NGS™ RNA Lib Prep Primer Mix for MGI

Sign In for Pricing
View Details
(E)-3-Cyclopentylprop-2-enoic Acid
TRC-E326005-2.5G 2.5 g

(E)-3-Cyclopentylprop-2-enoic Acid

Sign In for Pricing
View Details
CHN 1 (CHN1) (NM_001822) Human Over-expression Lysate
LC400688 20 µg

CHN 1 (CHN1) (NM_001822) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details