Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SBDS, Human (His)

The SBDS protein is indispensable for ribosome biogenesis and cooperates with EFL1 to trigger GTP-dependent EIF6 release from 60S preribosomes in the cytoplasm. This activates ribosomes, allowing 80S ribosome assembly and recycling of EIF6 to the nucleus. SBDS Protein, Human (His) is the recombinant human-derived SBDS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SBDS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sbds-protein-human-his.html

Purity

95.00

Smiles

MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

Molecular Formula

51119 (Gene_ID) Q9Y3A5 (M1-E250) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein E Recombinant Rabbit monoclonal Antibody
HA750206 100 µL

Apolipoprotein E Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
4,4'-Dichlorodiphenyl Ether
TRC-D438540-500MG 500 mg

4,4'-Dichlorodiphenyl Ether

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-01 24 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-02 48 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-03 96 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
Mouse Gpr182 activation kit by CRISPRa
GA200088 1 Kit

Mouse Gpr182 activation kit by CRISPRa

Sign In for Pricing
View Details