Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR54 Protein Vector (Rat) (pPB-C-His)
PV316378 500 ng

WDR54 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Arachis hypogaea (PNA, Peanut Agglutinin) (Gold, 10nm)
A3305-23A 1 mL

Arachis hypogaea (PNA, Peanut Agglutinin) (Gold, 10nm)

Sign In for Pricing
View Details
PHB2 (Y248) (BAP, REA, Prohibitin-2, B Cell Receptor-associated Protein BAP37, Repressor Of Estrogen Receptor Activity, D-prohibitin) (Biotin) discontinued
P9007-53F-Biotin 200 µL

PHB2 (Y248) (BAP, REA, Prohibitin-2, B Cell Receptor-associated Protein BAP37, Repressor Of Estrogen Receptor Activity, D-prohibitin) (Biotin) discontinued

Sign In for Pricing
View Details
Rat Monoclonal Meteorin-like/METRNL Antibody (829535) [PE/Atto594]
FAB66791PEATT594 0.1 mL

Rat Monoclonal Meteorin-like/METRNL Antibody (829535) [PE/Atto594]

Sign In for Pricing
View Details
Palladium (II) Iodide
P0900 1 g

Palladium (II) Iodide

Sign In for Pricing
View Details
Adgrl1 Rat siRNA Oligo Duplex (Locus ID 65096)
SR511617 1 Kit

Adgrl1 Rat siRNA Oligo Duplex (Locus ID 65096)

Sign In for Pricing
View Details