Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IDH3A Antibody (OTI2F11) [Allophycocyanin]
NBP2-70992APC 0.1 mL

Mouse Monoclonal IDH3A Antibody (OTI2F11) [Allophycocyanin]

Sign In for Pricing
View Details
ACRC (Acidic Repeat Containing, NAAR1)
588193 50 µg

ACRC (Acidic Repeat Containing, NAAR1)

Sign In for Pricing
View Details
Gel Casting Set for 5x6cm gels, includes casting tray 2 combs (18/10 teeth)
BM0290 1 Each

Gel Casting Set for 5x6cm gels, includes casting tray 2 combs (18/10 teeth)

Sign In for Pricing
View Details
MEK1 discontinued
402066-01 50 µL

MEK1 discontinued

Sign In for Pricing
View Details
MEK1 discontinued
402066-02 100 µL

MEK1 discontinued

Sign In for Pricing
View Details
Cdk4 Polyclonal Antibody
MBS8592904-01 0.1 mg

Cdk4 Polyclonal Antibody

Sign In for Pricing
View Details