Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGK012
MF-0120466-01 10 mg

CGK012

Sign In for Pricing
View Details
CGK012
MF-0120466-02 50 mg

CGK012

Sign In for Pricing
View Details
VPS37A Antibody
A49042-100UL 100 µL

VPS37A Antibody

Sign In for Pricing
View Details
Recombinant HIV-1 p24 Protein (group M, subtype D, strain NDK) (His Tag)
PKSV030194 100 µg

Recombinant HIV-1 p24 Protein (group M, subtype D, strain NDK) (His Tag)

Sign In for Pricing
View Details
Lentiviral human SLC16A4 sgRNA gene knockout kit - Lentiviral human SLC16A4 sgRNA gene knockout kit (plasmid)
GTR15395759 1 Vial

Lentiviral human SLC16A4 sgRNA gene knockout kit - Lentiviral human SLC16A4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
N-Acetyllactosamine-BSA discontinued
296708-01 2 mg

N-Acetyllactosamine-BSA discontinued

Sign In for Pricing
View Details