Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zkscan14-set siRNA/shRNA/RNAi Lentivector (Mouse)
51258094 4x 500 ng

Zkscan14-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
OR5AW1P sgRNA CRISPR Lentivector set (Human)
K1516901 3x 1.0 µg

OR5AW1P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MCP1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-41226R-APC-Cy7 100 µL

MCP1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
ATG2A Recombinant Protein Antigen
NBP1-83009PEP 0.1 mL

ATG2A Recombinant Protein Antigen

Sign In for Pricing
View Details
P-SMC1α (43.Ser 966) : m-IgGκ BP-HRP Bundle
sc-534619 1 Kit

P-SMC1α (43.Ser 966) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
GNG5P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0877107 1.0 µg DNA

GNG5P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details