Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Caspase 8 (Casp-8) ELISA Kit
SL1205Ra-01 48 Tests

Rat Caspase 8 (Casp-8) ELISA Kit

Sign In for Pricing
View Details
Rat Caspase 8 (Casp-8) ELISA Kit
SL1205Ra-02 96 Tests

Rat Caspase 8 (Casp-8) ELISA Kit

Sign In for Pricing
View Details
Brevican (BCAN) Rabbit Polyclonal Antibody
TA344597 100 µL

Brevican (BCAN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP6IP2 (ATP6AP2) Rabbit Polyclonal Antibody
TA364678 100 µL

ATP6IP2 (ATP6AP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGAP23 sgRNA CRISPR Lentivector (Human) (Target 3)
K0116304 1.0 µg DNA

ARHGAP23 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
hsa-miR-181a-3p miRNA Mimic
MBS8298122-01 5 nmol

hsa-miR-181a-3p miRNA Mimic

Sign In for Pricing
View Details