Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pantophysin Recombinant Antibody, PE Conjugated
bsm-62850R-PE 100 µL

Pantophysin Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Aim2 (NM_001013779) Mouse Tagged ORF Clone
MR200724 10 µg

Aim2 (NM_001013779) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Integrin Beta 3 (ITGb3) ELISA Kit
RDR-ITGb3-Hu-01 96 Tests

Human Integrin Beta 3 (ITGb3) ELISA Kit

Sign In for Pricing
View Details
Human Integrin Beta 3 (ITGb3) ELISA Kit
RDR-ITGb3-Hu-02 48 Tests

Human Integrin Beta 3 (ITGb3) ELISA Kit

Sign In for Pricing
View Details
PDGFB Protein Vector (Human) (pPB-N-His)
PV030526 500 ng

PDGFB Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) EXPB6 Polyclonal Antibody
MBS9001457 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) EXPB6 Polyclonal Antibody

Sign In for Pricing
View Details