Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SynGAP (SYNGAP1) Human qPCR Primer Pair (NM_006772)
HP209649 200 Reactions

SynGAP (SYNGAP1) Human qPCR Primer Pair (NM_006772)

Sign In for Pricing
View Details
Hoxa10 (NM_008263) Mouse Tagged ORF Clone Lentiviral Particle
MR206267L4V 200 µL

Hoxa10 (NM_008263) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-PTP4A1 / PRL-1 antibody
STJ70087 100 µg

Anti-PTP4A1 / PRL-1 antibody

Sign In for Pricing
View Details
CALCA (CT, KC, CGRP, CALC1, CGRP1, CGRP-I, Calcitonin Gene-related Peptide 1) (MaxLight 750)
MBS6409257-01 0.1 mL

CALCA (CT, KC, CGRP, CALC1, CGRP1, CGRP-I, Calcitonin Gene-related Peptide 1) (MaxLight 750)

Sign In for Pricing
View Details
CALCA (CT, KC, CGRP, CALC1, CGRP1, CGRP-I, Calcitonin Gene-related Peptide 1) (MaxLight 750)
MBS6409257-02 5x 0.1 mL

CALCA (CT, KC, CGRP, CALC1, CGRP1, CGRP-I, Calcitonin Gene-related Peptide 1) (MaxLight 750)

Sign In for Pricing
View Details
Goat Interferon β (IFN-β) ELISA Kit
YP-W75159-01 48 Tests

Goat Interferon β (IFN-β) ELISA Kit

Sign In for Pricing
View Details