Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-MYG1-EGFP-3xFLAG-Puro Plasmid
PVT70250 2 µg

PLV3-CMV-MYG1-EGFP-3xFLAG-Puro Plasmid

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os01g0953600 Polyclonal Antibody
MBS9004216 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os01g0953600 Polyclonal Antibody

Sign In for Pricing
View Details
RGD1304567 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
38904066 1.0 µg DNA

RGD1304567 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LOC100363112 Protein Vector (Rat) (pPM-C-His)
PV278061 500 ng

LOC100363112 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Enterovirus
bsm-72140M 100 µg

Enterovirus

Sign In for Pricing
View Details
Rabbit Polyclonal Ribosome maturation protein SBDS Antibody
NBP2-98463-50ul 50 µL

Rabbit Polyclonal Ribosome maturation protein SBDS Antibody

Sign In for Pricing
View Details