Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cadherin-8 (CDH8) ELISA Kit
abx504620 96 Tests

Mouse Cadherin-8 (CDH8) ELISA Kit

Sign In for Pricing
View Details
ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) APC
MBS6137178-01 0.1 mL

ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) APC

Sign In for Pricing
View Details
ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) APC
MBS6137178-02 5x 0.1 mL

ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) APC

Sign In for Pricing
View Details
Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (PL8-F6) [Alexa Fluor 532]
NBP2-47993AF532 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (PL8-F6) [Alexa Fluor 532]

Sign In for Pricing
View Details
Beta-Tocopherol
MBS3617578-01 2 mg

Beta-Tocopherol

Sign In for Pricing
View Details
Beta-Tocopherol
MBS3617578-02 5 mg

Beta-Tocopherol

Sign In for Pricing
View Details