Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HP1 gamma Recombinant Antibody, Cy5.5 Conjugated
bsm-61603R-Cy5.5 100 µL

HP1 gamma Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral human CD1E shRNA (UAS) - Lentiviral human CD1E shRNA (UAS, iRFP) (100)
GTR15328314 1 Vial

Lentiviral human CD1E shRNA (UAS) - Lentiviral human CD1E shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RT1-Db1 Protein Vector (Rat) (pPB-C-His)
PV302818 500 ng

RT1-Db1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
GABPB1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV710307 1.0 µg DNA

GABPB1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
14-3-3 beta (YWHAB) Rabbit Polyclonal Antibody
TA322853 100 µL

14-3-3 beta (YWHAB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NADK Matched Antibody Pair Set [IV11990/Poly]
Z01LS-1122-LS474 5 Plates

Human NADK Matched Antibody Pair Set [IV11990/Poly]

Sign In for Pricing
View Details