Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type IV (COL4) Antibody
abx411164 200 µg

Collagen Type IV (COL4) Antibody

Sign In for Pricing
View Details
Human LCTL qPCR Primer Pair
QH67585S 200 Tests

Human LCTL qPCR Primer Pair

Sign In for Pricing
View Details
MafA Protein Vector (Human) (pPM-C-HA)
PV092860 500 ng

MafA Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CCDC117 (Coiled-coil Domain Containing Protein 117, Coiled-coil Domain Containing 117)
477233 100 µL

CCDC117 (Coiled-coil Domain Containing Protein 117, Coiled-coil Domain Containing 117)

Sign In for Pricing
View Details
PAX5 Antibody
V5273SAF-100UG 100 µg

PAX5 Antibody

Sign In for Pricing
View Details
TXNDC17 cDNA Clone
MBS1270345-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TXNDC17 cDNA Clone

Sign In for Pricing
View Details