Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-human-hek-293-his.html

Purity

95.00

Smiles

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Formula

7076 (Gene_ID) P01033 (C24-A207) (Accession)

Molecular Weight

Approximately 27.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSC1, CT (TSSC1, Protein TSSC1, Tumor-suppressing STF cDNA 1 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein) (MaxLight 550) discontinued
043395-ML550 100 µL

TSSC1, CT (TSSC1, Protein TSSC1, Tumor-suppressing STF cDNA 1 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
4930563M21Rik (NM_183111) Mouse Tagged Lenti ORF Clone
MR225232L3 10 µg

4930563M21Rik (NM_183111) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine oxidizided glutathione, GSSG ELISA Kit
YLA0356BO-01 48 Tests

Bovine oxidizided glutathione, GSSG ELISA Kit

Sign In for Pricing
View Details
Bovine oxidizided glutathione, GSSG ELISA Kit
YLA0356BO-02 96 Tests

Bovine oxidizided glutathione, GSSG ELISA Kit

Sign In for Pricing
View Details
Monoclonal Carcinoembryonic Antigen (CEA) / CD66 Antibody - Without BSA and Azide, Clone: COL-1 + CEA31 + C66/261
AMM00226G 0.1mg

Monoclonal Carcinoembryonic Antigen (CEA) / CD66 Antibody - Without BSA and Azide, Clone: COL-1 + CEA31 + C66/261

Sign In for Pricing
View Details
GENLISA™ Human Adenylyl Cyclase Associated Protein 2 (CAP2) ELISA
KBH20346 1x 96 Well

GENLISA™ Human Adenylyl Cyclase Associated Protein 2 (CAP2) ELISA

Sign In for Pricing
View Details