Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC3L Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to ORC3 also known as Origin recognition complex subunit Latheo, whose expression can be detected in the eye and duodenum but is highly expressive in the dura mater and dorsal thalamus. It is found in the nucleus. This protein is a component of the origin recognition complex (ORC) that binds origins of replication while DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3.

Product Specifications

Product Name Alternative

Anti-LAT antibody, anti-LATHEO antibody, anti-ORC3 antibody, anti-ORC3L antibody

UniProt

Q9UBD5

Reactivity

Human

Target

ORC3

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: VVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVA

Field of Research

Cell Biology

Purification

Affinity Purified

Concentration

0.5 - 1 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

82kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_862820

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)
MBS2123592-01 0.01 mg

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)

Sign In for Pricing
View Details
Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)
MBS2123592-02 0.05 mg

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)

Sign In for Pricing
View Details
Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)
MBS2123592-03 0.1 mg

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)

Sign In for Pricing
View Details
Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)
MBS2123592-04 0.2 mg

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)

Sign In for Pricing
View Details
Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)
MBS2123592-05 0.5 mg

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)

Sign In for Pricing
View Details
Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)
MBS2123592-06 1 mg

Recombinant Adaptor Related Protein Complex 1 Beta 1 (AP1b1)

Sign In for Pricing
View Details