BD-4, Rat
BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.
Product Specifications
Product Name Alternative
BD-4 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bd-4-protein-rat.html
Purity
95.0
Smiles
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
Molecular Formula
64389 (Gene_ID) O88514 (Q23-K63) (Accession)
Molecular Weight
Approximately 10.8 kDa
References & Citations
[1]García JR, et al. Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001 Aug;15 (10) :1819-21.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6307032-01 0.2 mL
HKR1, NT (HKR1, ZNF875, Krueppel-related zinc finger protein 1, Protein HKR1, Zinc finger protein 875) (PE)
Sign In for Pricing
View Details MBS6307032-02 5x 0.2 mL
HKR1, NT (HKR1, ZNF875, Krueppel-related zinc finger protein 1, Protein HKR1, Zinc finger protein 875) (PE)
Sign In for Pricing
View Details 
MBS6374651-01 0.1 mL
CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-binding Protein II) (MaxLight 650)
Sign In for Pricing
View Details MBS6374651-02 5x 0.1 mL
CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-binding Protein II) (MaxLight 650)
Sign In for Pricing
View Details 23269061 1.0 µg DNA
HIGD1AP12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details