Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-4, Rat

BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.

Product Specifications

Product Name Alternative

BD-4 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-4-protein-rat.html

Purity

95.0

Smiles

QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK

Molecular Formula

64389 (Gene_ID) O88514 (Q23-K63) (Accession)

Molecular Weight

Approximately 10.8 kDa

References & Citations

[1]García JR, et al. Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001 Aug;15 (10) :1819-21.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSN, ID (TSN, Translin, Component 3 of promoter of RISC) (APC) discontinued
043369-APC 200 µL

TSN, ID (TSN, Translin, Component 3 of promoter of RISC) (APC) discontinued

Sign In for Pricing
View Details
Shank 2 (A-11) : m-IgG1 BP-HRP Bundle
sc-543426 1 Kit

Shank 2 (A-11) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Sp110 Antibody
E51A06277 100 µL

Sp110 Antibody

Sign In for Pricing
View Details
Anti-SRTD1 antibody
STJ193018 200 µl

Anti-SRTD1 antibody

Sign In for Pricing
View Details
PF-5274857 2mg
A12775-2 2 mg

PF-5274857 2mg

Sign In for Pricing
View Details
Daxx
522161-01 100 µL

Daxx

Sign In for Pricing
View Details