Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-4, Rat

BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.

Product Specifications

Product Name Alternative

BD-4 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-4-protein-rat.html

Purity

95.0

Smiles

QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK

Molecular Formula

64389 (Gene_ID) O88514 (Q23-K63) (Accession)

Molecular Weight

Approximately 10.8 kDa

References & Citations

[1]García JR, et al. Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001 Aug;15 (10) :1819-21.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siglec 6, NT (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (MaxLight 550)
MBS6499403-01 0.1 mL

Siglec 6, NT (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (MaxLight 550)

Sign In for Pricing
View Details
Siglec 6, NT (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (MaxLight 550)
MBS6499403-02 5x 0.1 mL

Siglec 6, NT (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (MaxLight 550)

Sign In for Pricing
View Details
PP2Abeta Antibody
orb2671166-01 50 µL

PP2Abeta Antibody

Sign In for Pricing
View Details
PP2Abeta Antibody
orb2671166-02 100 µL

PP2Abeta Antibody

Sign In for Pricing
View Details
PP2Abeta Antibody
orb2671166-03 200 µL

PP2Abeta Antibody

Sign In for Pricing
View Details
Coronavirus (CoV-NP 229E) Antigen, Recombinant >95%
MBS569921-01 10 mg

Coronavirus (CoV-NP 229E) Antigen, Recombinant >95%

Sign In for Pricing
View Details