Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAN Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to RAN

Product Specifications

Product Name Alternative

Anti ARA24 antibody, anti Gsp1 antibody, anti TC4 antibody

UniProt

P62826

Reactivity

Human, Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAN

Target

RAN

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Field of Research

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

24kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17) (MaxLight 650)
MBS6390106-01 0.1 mL

POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17) (MaxLight 650)

Sign In for Pricing
View Details
POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17) (MaxLight 650)
MBS6390106-02 5x 0.1 mL

POLE3 (DNA Polymerase epsilon Subunit 3, Arsenic-transactivated Protein, AsTP, Chromatin Accessibility Complex 17kD Protein, CHRAC-17, HuCHRAC17, DNA Polymerase II Subunit 3, DNA Polymerase epsilon Subunit p17, CHRAC17) (MaxLight 650)

Sign In for Pricing
View Details
Anti-Proteasome 20S beta 7/PSMB7 Antibody Picoband® (monoclonal, 3H6C8), HRP Conjugate
M08095-2-HRP 100 µg/Vial

Anti-Proteasome 20S beta 7/PSMB7 Antibody Picoband® (monoclonal, 3H6C8), HRP Conjugate

Sign In for Pricing
View Details
Human Myomesin-3, MYOM3 ELISA KIT
ELI-16639h 96 Tests

Human Myomesin-3, MYOM3 ELISA KIT

Sign In for Pricing
View Details
Human Carbohydrate Antigen 125 (CA125) ELISA Kit
MBS2020370-01 24 Strip Well

Human Carbohydrate Antigen 125 (CA125) ELISA Kit

Sign In for Pricing
View Details
Human Carbohydrate Antigen 125 (CA125) ELISA Kit
MBS2020370-02 48 Well

Human Carbohydrate Antigen 125 (CA125) ELISA Kit

Sign In for Pricing
View Details