Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT5B, Human (His)

The STAT5B protein plays dual roles in signal transduction and transcriptional activation in response to KITLG/SCF and growth factors. STAT5B Protein, Human (His) is the recombinant human-derived STAT5B protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT5B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat5b-protein-human-his.html

Purity

95.00

Smiles

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATIT

Molecular Formula

6777 (Gene_ID) P51692 (M1-T321) (Accession)

Molecular Weight

Approximately 38.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PREX1 Goat Polyclonal Antibody
TA311494 100 µg

PREX1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
CA057 Antibody
8C11606-AAT 50 µg

CA057 Antibody

Sign In for Pricing
View Details
ARHGEF19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12328061 1.0 µg DNA

ARHGEF19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-NECL-1 Rabbit pAb
GB111898-50 50 μL

Anti-NECL-1 Rabbit pAb

Sign In for Pricing
View Details
Anti-MEK7 (Recombinant Rabbit, Monoclonal, IgG)
A116302 100 µL

Anti-MEK7 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
OACA12602-50UL
OACA12602-50UL 50 µL

OACA12602-50UL

Sign In for Pricing
View Details