Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT5B, Human (His)

The STAT5B protein plays dual roles in signal transduction and transcriptional activation in response to KITLG/SCF and growth factors. STAT5B Protein, Human (His) is the recombinant human-derived STAT5B protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT5B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat5b-protein-human-his.html

Purity

95.00

Smiles

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATIT

Molecular Formula

6777 (Gene_ID) P51692 (M1-T321) (Accession)

Molecular Weight

Approximately 38.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium Chloride Solution (10%)
B2012090 50 mL

Calcium Chloride Solution (10%)

Sign In for Pricing
View Details
Stat1 (NM_001034164) Rat Tagged Lenti ORF Clone
RR200448L3 10 µg

Stat1 (NM_001034164) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfr677 Mouse shRNA Lentiviral Particle (Locus ID 258355)
TL517205V 500 µL Each

Olfr677 Mouse shRNA Lentiviral Particle (Locus ID 258355)

Sign In for Pricing
View Details
1,1,1-Kestopentaose
TRC-K264853-10MG 10 mg

1,1,1-Kestopentaose

Sign In for Pricing
View Details
NUP153 Human shRNA Plasmid Kit (Locus ID 9972)
TR311062 1 Kit

NUP153 Human shRNA Plasmid Kit (Locus ID 9972)

Sign In for Pricing
View Details
FGFR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678933 1.0 µg DNA

FGFR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details