Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 2/IFNA2, Mouse

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

IFN-alpha 2/IFNA2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-2-protein-mouse.html

Purity

98.0

Smiles

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Molecular Formula

15965 (Gene_ID) P01573 (C24-E190) (Accession)

Molecular Weight

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXNB2 Rabbit Polyclonal Antibody (Carrier-free)
orb3097819 100 µg

PLXNB2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
3440-G Die-cut & Printed Numbers & Letters
034417 250 Pack (10 Label (s) x 25 Card)

3440-G Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
TCEAL4 (NM_024863) Human Untagged Clone
SC111977 10 µg

TCEAL4 (NM_024863) Human Untagged Clone

Sign In for Pricing
View Details
USP9Y antibody - C-terminal region (ARP59337_P050)
ARP59337_P050 100 µL

USP9Y antibody - C-terminal region (ARP59337_P050)

Sign In for Pricing
View Details
Mouse Monoclonal HLA Class I Antibody (MEM-81) [mFluor Violet 450 SE]
NB500-412MFV450 0.1 mL

Mouse Monoclonal HLA Class I Antibody (MEM-81) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
ACAD11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV704667 1.0 µg DNA

ACAD11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details