Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 protein (IL3) (P27S) (Active)

Product Specifications

Product Name Alternative

IL-3, Mast cell growth factor, MCGF, Multipotential colony-stimulating factor, P-cell-stimulating factor

Abbreviation

Recombinant Human IL3 protein (P27S) (Active)

Gene Name

IL3

UniProt

P08700

Expression Region

20-152aa (P27S)

Organism

Homo sapiens (Human)

Target Sequence

APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 107 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5a-Androst-1-ene-3a,17b-diol 3-p-Nitrobenzyl Ether 17-Acetate
TRC-A653280-50MG 50 mg

5a-Androst-1-ene-3a,17b-diol 3-p-Nitrobenzyl Ether 17-Acetate

Sign In for Pricing
View Details
Sodium (2S,4S)-4-Cyclohexyl-1-(3-oxopentanoyl)pyrrolidine-2-carboxylate
TRC-S111390-50MG 50 mg

Sodium (2S,4S)-4-Cyclohexyl-1-(3-oxopentanoyl)pyrrolidine-2-carboxylate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain,  5nm
GM-101-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain, 5nm

Sign In for Pricing
View Details
IGF2BP1 (NM_006546) Human Recombinant Protein
TP316226 20 µg

IGF2BP1 (NM_006546) Human Recombinant Protein

Sign In for Pricing
View Details
ALDH9A1 (NM_000696) Human Over-expression Lysate
LC424566 20 µg

ALDH9A1 (NM_000696) Human Over-expression Lysate

Sign In for Pricing
View Details
NCBP2 Human Gene Knockout Kit (CRISPR)
KN401519 1 Kit

NCBP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details