Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-7, Mouse (CHO, His)

IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.

Product Specifications

Product Name Alternative

IL-7 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-7-protein-mouse-cho.html

Purity

95.30

Smiles

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Molecular Formula

16196 (Gene_ID) P10168/Q544C8/NP_032397.1 (E26-I154) (Accession)

Molecular Weight

Approximately 8-28 kDabased on SDS-PAGE under reducing conditions.

References & Citations

++

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydroxy-5-(1-hydroxyethyl)benzamide
TRC-H415055-500MG 500 mg

2-Hydroxy-5-(1-hydroxyethyl)benzamide

Sign In for Pricing
View Details
C22orf46 Human Gene Knockout Kit (CRISPR)
KN426585 1 Kit

C22orf46 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC25A45 (NM_001077241) Human Over-expression Lysate
LY421389 100 µg

SLC25A45 (NM_001077241) Human Over-expression Lysate

Sign In for Pricing
View Details
VTI1A (NM_145206) Human Recombinant Protein
TP313934 20 µg

VTI1A (NM_145206) Human Recombinant Protein

Sign In for Pricing
View Details
Itpr1 Mouse Monoclonal Antibody [Clone ID: L24/18]
75-035 100 µL

Itpr1 Mouse Monoclonal Antibody [Clone ID: L24/18]

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF405S conjugate, 0.1mg/mL
BNC040870-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details