Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-7, Mouse (CHO, His)

IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.

Product Specifications

Product Name Alternative

IL-7 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-7-protein-mouse-cho.html

Purity

95.30

Smiles

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Molecular Formula

16196 (Gene_ID) P10168/Q544C8/NP_032397.1 (E26-I154) (Accession)

Molecular Weight

Approximately 8-28 kDabased on SDS-PAGE under reducing conditions.

References & Citations

++

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha 5 (ITGA5) Mouse Monoclonal Antibody [Clone ID: 10F6]
AM06388SU-N 100 µL

Integrin alpha 5 (ITGA5) Mouse Monoclonal Antibody [Clone ID: 10F6]

Sign In for Pricing
View Details
PSMB3 Rabbit Polyclonal Antibody
HA500458 100 µL

PSMB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF405S conjugate, 0.1mg/mL
BNC043566-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human UBE2J2 Protein (GST Tag)
PKSH033185-01 10 µg

Recombinant Human UBE2J2 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human UBE2J2 Protein (GST Tag)
PKSH033185-02 50 µg

Recombinant Human UBE2J2 Protein (GST Tag)

Sign In for Pricing
View Details
1,3-Diisopropylurea
TRC-D459850-50MG 50 mg

1,3-Diisopropylurea

Sign In for Pricing
View Details