Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-7, Mouse (CHO, His)

IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.

Product Specifications

Product Name Alternative

IL-7 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-7-protein-mouse-cho.html

Purity

95.30

Smiles

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Molecular Formula

16196 (Gene_ID) P10168/Q544C8/NP_032397.1 (E26-I154) (Accession)

Molecular Weight

Approximately 8-28 kDabased on SDS-PAGE under reducing conditions.

References & Citations

++

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fructosamine 3 Kinase Related Protein (FN3KRP) Antibody
abx122474-01 100 µg

Fructosamine 3 Kinase Related Protein (FN3KRP) Antibody

Sign In for Pricing
View Details
Fructosamine 3 Kinase Related Protein (FN3KRP) Antibody
abx122474-02 1 mg

Fructosamine 3 Kinase Related Protein (FN3KRP) Antibody

Sign In for Pricing
View Details
SPATA7 Human Gene Knockout Kit (CRISPR)
KN410350 1 Kit

SPATA7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P27 KIP 1 Rabbit Polyclonal Antibody
54270-01 50 µL

P27 KIP 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P27 KIP 1 Rabbit Polyclonal Antibody
54270-02 100 µL

P27 KIP 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kv4.2 Rabbit Polyclonal Antibody (BF488)
orb2376329 100 µL

Kv4.2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details