Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF b 1 Human, GST

The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag) .

Product Specifications

Swiss Prot

P01137

Source

Escherichia Coli.

Buffer

The protein solution (500 µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced) .

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.

Sequence Similarities

KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KLKB1, CT (KLKB1, KLK3, Plasma kallikrein, Fletcher factor, Kininogenin, Plasma prekallikrein, Plasma kallikrein heavy chain, Plasma kallikrein light chain) (FITC) discontinued
037574-FITC 200 µL

KLKB1, CT (KLKB1, KLK3, Plasma kallikrein, Fletcher factor, Kininogenin, Plasma prekallikrein, Plasma kallikrein heavy chain, Plasma kallikrein light chain) (FITC) discontinued

Ask
View Details
SUV420H1 Protein Lysate (Rat) with C-HA Tag
45913036 100 µg

SUV420H1 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)
MBS2072873-01 0.1 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)
MBS2072873-02 0.2 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)
MBS2072873-03 0.5 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)
MBS2072873-04 1 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A5 (PDIA5)

Ask
View Details