TGF b 1 Human, GST
The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag) .
Product Specifications
Swiss Prot
P01137
Source
Escherichia Coli.
Buffer
The protein solution (500 µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced) .
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
Sequence Similarities
KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRK
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items