Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF b 1 Human, GST

The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag) .

Product Specifications

Swiss Prot

P01137

Source

Escherichia Coli.

Buffer

The protein solution (500 µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced) .

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.

Product Datasheet

https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97396

Sequence Similarities

KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Interleukin 1 alpha (IL-1a) (HRP)
MBS6482308-01 0.1 mL

Interleukin 1 alpha (IL-1a) (HRP)

Ask
View Details
Interleukin 1 alpha (IL-1a) (HRP)
MBS6482308-02 5x 0.1 mL

Interleukin 1 alpha (IL-1a) (HRP)

Ask
View Details
Human CCDC126 shRNA Plasmid
abx963977-01 150 µg

Human CCDC126 shRNA Plasmid

Ask
View Details
Human CCDC126 shRNA Plasmid
abx963977-02 300 µg

Human CCDC126 shRNA Plasmid

Ask
View Details
Goat anti-Human IgG (H&L) - Affinity Pure, Biotin Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins
MBS687232-01 1 mg

Goat anti-Human IgG (H&L) - Affinity Pure, Biotin Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins

Ask
View Details
Goat anti-Human IgG (H&L) - Affinity Pure, Biotin Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins
MBS687232-02 5x 1 mg

Goat anti-Human IgG (H&L) - Affinity Pure, Biotin Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins

Ask
View Details