Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF b 3 Human, Plant

TGFB3 Human Recombinant produced in plant is a disulfide-linked homodimeric, glycosylated, polypeptide chain containing 118 amino acids and having a molecular mass of 27.2kDa.

Product Specifications

Swiss Prot

P10600

Source

Nicotiana benthamiana.

Buffer

Lyophilized from a concentrated (1 mg/mL) solution containing 50mM Tris-HCl pH-7.4.

Storage Conditions

Lyophilized TGFB3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB3 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Sequence Similarities

HHHHHALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

QuantGene 9600 Fluorescent Quantitative Detection System
BYF6A06E 1 Unit

QuantGene 9600 Fluorescent Quantitative Detection System

Ask
View Details
Mouse Monoclonal MICB Antibody (236511) [DyLight 680]
FAB1599Y 0.1 mL

Mouse Monoclonal MICB Antibody (236511) [DyLight 680]

Ask
View Details
Human MUC3 (Mucin 3) ELISA Kit
EK241249 96 Well

Human MUC3 (Mucin 3) ELISA Kit

Ask
View Details
Mouse Anti-Chicken IgY (H&L) HRP
E51S2135 100 µL

Mouse Anti-Chicken IgY (H&L) HRP

Ask
View Details
Human SP-D Affinity Purified Polyclonal Ab
AF1920 100 µg

Human SP-D Affinity Purified Polyclonal Ab

Ask
View Details
Tissue FFPE Sections, Kidney
CS805829 5x 5 µm

Tissue FFPE Sections, Kidney

Ask
View Details