CD131, Rat (HEK293, Fc)
The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD131 Protein, Rat (HEK293, Fc), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd131-protein-rat-hek293-fc.html
Purity
98.0
Smiles
EETVPLKTLQCYNDYIERIICSWADTEDAQGLVNLTLYHWLDKKQPMSCELSEDLMWSECPSSHRCVPRRCVLPYTQFSVSKEDYYSLQPDRDLSIHLVVPLAQHVQPPPPKDISISPSGDHFLLKWSVPLGDAQVSLLSQKDIQFEVAYKQLQDSWEDASSLHTCNLWVTLEPKLFLPNSIYVARVRAQLAPGSSLSGRPSGWSPEVHWDSPTEDKARPQNLQCFFDGIQSLNCSWEVWTKVTDSVSFGLFYSSSPKAGEKKCSPVVKELQASRYTRYHCSLNVSDPAAHSQYTVSVKRLEQGKFIESFNHIQMNPPTLNLTKNRDSYSLHWETQKMSYPFIQHAFQVQYKKKLDRWEDSKTENLNHAHSMDLPQLEPGTSYCARVRVKTIPEYKGLWSEWSNECTWTTDW
Molecular Formula
171081 (Gene_ID) Q78ZF5 (E29-W440) (Accession)
Molecular Weight
Approximately 80-95 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS051397-01 48 Well
Monkey Tumor Necrosis Factor Receptor Superfamily, Member 17 ELISA Kit
Sign In for Pricing
View Details MBS051397-02 96 Well
Monkey Tumor Necrosis Factor Receptor Superfamily, Member 17 ELISA Kit
Sign In for Pricing
View Details MBS051397-03 5x 96 Well
Monkey Tumor Necrosis Factor Receptor Superfamily, Member 17 ELISA Kit
Sign In for Pricing
View Details MBS051397-04 10x 96 Well
Monkey Tumor Necrosis Factor Receptor Superfamily, Member 17 ELISA Kit
Sign In for Pricing
View Details