CD131, Rat (HEK293, Fc)
The CD131 protein is a cell surface receptor that plays a critical role in the immune response and controls the generation and differentiation of hematopoietic progenitor cells. CD131 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD131 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD131 Protein, Rat (HEK293, Fc), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd131-protein-rat-hek293-fc.html
Purity
98.0
Smiles
EETVPLKTLQCYNDYIERIICSWADTEDAQGLVNLTLYHWLDKKQPMSCELSEDLMWSECPSSHRCVPRRCVLPYTQFSVSKEDYYSLQPDRDLSIHLVVPLAQHVQPPPPKDISISPSGDHFLLKWSVPLGDAQVSLLSQKDIQFEVAYKQLQDSWEDASSLHTCNLWVTLEPKLFLPNSIYVARVRAQLAPGSSLSGRPSGWSPEVHWDSPTEDKARPQNLQCFFDGIQSLNCSWEVWTKVTDSVSFGLFYSSSPKAGEKKCSPVVKELQASRYTRYHCSLNVSDPAAHSQYTVSVKRLEQGKFIESFNHIQMNPPTLNLTKNRDSYSLHWETQKMSYPFIQHAFQVQYKKKLDRWEDSKTENLNHAHSMDLPQLEPGTSYCARVRVKTIPEYKGLWSEWSNECTWTTDW
Molecular Formula
171081 (Gene_ID) Q78ZF5 (E29-W440) (Accession)
Molecular Weight
Approximately 80-95 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942076-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742810-500 1x 500 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details