Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL R Human

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.

Product Specifications

Swiss Prot

P16471

Source

Escherichia Coli.

Buffer

The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.

Storage Conditions

Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .

Sequence Similarities

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human FBLN1 Matched Antibody Pair Set [ABP-S-051749]
ABP-S-051749 5 Plates

Human FBLN1 Matched Antibody Pair Set [ABP-S-051749]

Ask
View Details
Lucenin 3
HY-N12061-01 1 mg

Lucenin 3

Ask
View Details
Lucenin 3
HY-N12061-02 5 mg

Lucenin 3

Ask
View Details
Porcine Anti Laminaribioside Antibody ELISA Kit
MBS7280124-01 48 Well

Porcine Anti Laminaribioside Antibody ELISA Kit

Ask
View Details
Porcine Anti Laminaribioside Antibody ELISA Kit
MBS7280124-02 96 Well

Porcine Anti Laminaribioside Antibody ELISA Kit

Ask
View Details
Porcine Anti Laminaribioside Antibody ELISA Kit
MBS7280124-03 5x 96 Well

Porcine Anti Laminaribioside Antibody ELISA Kit

Ask
View Details