PRL R Human
Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.
Product Specifications
Swiss Prot
P16471
Source
Escherichia Coli.
Buffer
The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.
Storage Conditions
Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .
Product Datasheet
https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97074
Sequence Similarities
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items