Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL R Human

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.

Product Specifications

Swiss Prot

P16471

Source

Escherichia Coli.

Buffer

The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.

Storage Conditions

Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .

Product Datasheet

https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97074

Sequence Similarities

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CDA Antibody (Center) [AMM22158G]
AMM22158G-01 50 µL

CDA Antibody (Center) [AMM22158G]

Ask
View Details
CDA Antibody (Center) [AMM22158G]
AMM22158G-02 100 µL

CDA Antibody (Center) [AMM22158G]

Ask
View Details
CDA Antibody (Center) [AMM22158G]
AMM22158G-03 200 µL

CDA Antibody (Center) [AMM22158G]

Ask
View Details
CDA Antibody (Center) [AMM22158G]
AMM22158G-04 400 µL

CDA Antibody (Center) [AMM22158G]

Ask
View Details
H TMEM173 (H232R) (GFP-Puro) Expression Lentivirus
LVP1696 1x 10^8 IFU/mL x 200 μL

H TMEM173 (H232R) (GFP-Puro) Expression Lentivirus

Ask
View Details
P/P066/NL432/PE-150X50-1 Prohibited Activity Signs & Labels (Adhesive)
300166 1 Pack (1 Panel (s) x 1 Pack)

P/P066/NL432/PE-150X50-1 Prohibited Activity Signs & Labels (Adhesive)

Ask
View Details