Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL R Human

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.

Product Specifications

Swiss Prot

P16471

Source

Escherichia Coli.

Buffer

The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.

Storage Conditions

Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .

Sequence Similarities

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FLT3/CDK4-IN-1
MBS5805809 Inquire

FLT3/CDK4-IN-1

Ask
View Details
Mouse Rtbdn Pre-designed siRNA Set A
SI112353A 1 Each

Mouse Rtbdn Pre-designed siRNA Set A

Ask
View Details
Anti-Human/Mouse CD44 Antibody [IM7], FITC-100ug
QAB39-F-100ug 100ug

Anti-Human/Mouse CD44 Antibody [IM7], FITC-100ug

Ask
View Details
Recombinant Pinus thunbergii Photosystem II reaction center protein Z (psbZ)
MBS7028023-01 0.02 mg

Recombinant Pinus thunbergii Photosystem II reaction center protein Z (psbZ)

Ask
View Details
Recombinant Pinus thunbergii Photosystem II reaction center protein Z (psbZ)
MBS7028023-02 0.1 mg

Recombinant Pinus thunbergii Photosystem II reaction center protein Z (psbZ)

Ask
View Details
Recombinant Pinus thunbergii Photosystem II reaction center protein Z (psbZ)
MBS7028023-03 5x 0.1 mg

Recombinant Pinus thunbergii Photosystem II reaction center protein Z (psbZ)

Ask
View Details