Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL R Human

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.

Product Specifications

Swiss Prot

P16471

Source

Escherichia Coli.

Buffer

The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.

Storage Conditions

Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .

Sequence Similarities

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Neisseria Gonorrhoeae Antibody
GWB-BCFE9E 0.2 mg

Neisseria Gonorrhoeae Antibody

Ask
View Details
Fam57b (NM_029978) Mouse Untagged Clone
MC210825 10 µg

Fam57b (NM_029978) Mouse Untagged Clone

Ask
View Details
SLS Lab Pro Reverse Osmosis PURA-Q Choice 20 Type 3 Water Purifier 20L/hr 200L/day
WAT2406 1 Each

SLS Lab Pro Reverse Osmosis PURA-Q Choice 20 Type 3 Water Purifier 20L/hr 200L/day

Ask
View Details
Mouse Monoclonal CD42b/GPIb alpha Antibody (HIP1) [Alexa Fluor 532]
NB500-511AF532 0.1 mL

Mouse Monoclonal CD42b/GPIb alpha Antibody (HIP1) [Alexa Fluor 532]

Ask
View Details
Xpress™ Human VLDLR Over-expressing Stable Cell Line
ABC-X3402 1 Vial

Xpress™ Human VLDLR Over-expressing Stable Cell Line

Ask
View Details
Oprk1 Mouse shRNA Plasmid (Locus ID 18387)
TL501555 1 Kit

Oprk1 Mouse shRNA Plasmid (Locus ID 18387)

Ask
View Details