Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL R Human

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.

Product Specifications

Swiss Prot

P16471

Source

Escherichia Coli.

Buffer

The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.

Storage Conditions

Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .

Product Datasheet

https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97074

Sequence Similarities

AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-CD20 Antibody [2H7], PerCP-Cy5.5-100Tests
QAB31-PCP55-100Tests 100Tests

Anti-CD20 Antibody [2H7], PerCP-Cy5.5-100Tests

Ask
View Details
SARS-CoV-2 Spike protein (S1)
Z03501-1 1 mg

SARS-CoV-2 Spike protein (S1)

Ask
View Details
RAB36 Antibody
E38PA3035 100 µL

RAB36 Antibody

Ask
View Details
FRA4C CRISPR All-in-one AAV vector set (with saCas9)(Human)
20890151 3x1.0μg DNA

FRA4C CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Recombinant Meyerozyma guilliermondii Ribosome-releasing factor 2, mitochondrial (MEF2), partial
MBS1145858 Inquire

Recombinant Meyerozyma guilliermondii Ribosome-releasing factor 2, mitochondrial (MEF2), partial

Ask
View Details
Chrnd (NM_021600) Mouse Tagged Lenti ORF Clone
MR222857L3 10 µg

Chrnd (NM_021600) Mouse Tagged Lenti ORF Clone

Ask
View Details