Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF C Rat

Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Product Specifications

Swiss Prot

P16612

Source

Sf9, Insect Cells.

Buffer

Each mg of VEGF-C Rat contains 50 mg BSA and PBS as buffer.

Storage Conditions

Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSII

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Deoxypseudouridine
sc-283490 1 mg

2'-Deoxypseudouridine

Sign In for Pricing
View Details
Sulfuric acid discontinued
289012-01 25 g

Sulfuric acid discontinued

Sign In for Pricing
View Details
Sulfuric acid discontinued
289012-02 50 g

Sulfuric acid discontinued

Sign In for Pricing
View Details
Sulfuric acid discontinued
289012-03 100 g

Sulfuric acid discontinued

Sign In for Pricing
View Details
Sulfuric acid discontinued
289012-04 250 g

Sulfuric acid discontinued

Sign In for Pricing
View Details
Sulfuric acid discontinued
289012-05 500 g

Sulfuric acid discontinued

Sign In for Pricing
View Details