Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF C Rat

Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Product Specifications

Swiss Prot

P16612

Source

Sf9, Insect Cells.

Buffer

Each mg of VEGF-C Rat contains 50 mg BSA and PBS as buffer.

Storage Conditions

Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSII

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS24P5 sgRNA CRISPR Lentivector set (Human)
K2045601 3x 1.0 µg

RPS24P5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
5(10)-Estrene-3beta,17alphalpha-diol
TRC-E887900-100MG 100 mg

5(10)-Estrene-3beta,17alphalpha-diol

Sign In for Pricing
View Details
TSH-Receptor, A-Chain (Thyroid Marker) (TSHRA/1402), CF594 conjugate, 0.1mg/mL
BNC941402-100 1x 100 µL

TSH-Receptor, A-Chain (Thyroid Marker) (TSHRA/1402), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAU2 chromatid cohesion factor homolog
AP87526-01 50 µg

MAU2 chromatid cohesion factor homolog

Sign In for Pricing
View Details
MAU2 chromatid cohesion factor homolog
AP87526-02 100 µg

MAU2 chromatid cohesion factor homolog

Sign In for Pricing
View Details
MAU2 chromatid cohesion factor homolog
AP87526-03 1 mg

MAU2 chromatid cohesion factor homolog

Sign In for Pricing
View Details