Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF C Rat

Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Product Specifications

Swiss Prot

P16612

Source

Sf9, Insect Cells.

Buffer

Each mg of VEGF-C Rat contains 50 mg BSA and PBS as buffer.

Storage Conditions

Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSII

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Interleukin 18 (IL18) ELISA Kit
DLR-IL18-Ch-48T 48 Tests

Chicken Interleukin 18 (IL18) ELISA Kit

Sign In for Pricing
View Details
PET112L Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11667R-BF405 100 µL

PET112L Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Leucine Rich Repeat Containing 41 (LRRC41) Antibody
abx113466 100 µL

Leucine Rich Repeat Containing 41 (LRRC41) Antibody

Sign In for Pricing
View Details
RNF19A sgRNA CRISPR Lentivector (Human) (Target 1)
K1835202 1.0 µg DNA

RNF19A sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Olr1735 3'UTR Lenti-reporter-Luc Vector
34172086 1.0 µg

Olr1735 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PFDN1 antibody (biotin)
60R-2175 100 ug

PFDN1 antibody (biotin)

Sign In for Pricing
View Details