Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Human, 209 a.a

Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa.

Product Specifications

Swiss Prot

P13725

Source

Escherichia Coli.

Buffer

Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1 mg/mL) solution containing 1x PBS pH-7.4.

Storage Conditions

Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.

Product Datasheet

https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97166

Sequence Similarities

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GPBAR1 Human qPCR Primer Pair (NM_170699)
HP227599 200 Reactions

GPBAR1 Human qPCR Primer Pair (NM_170699)

Ask
View Details
Mouse Monoclonal CD39/ENTPD1 Antibody (498403) [Janelia Fluor 549]
FAB4397I 0.1 mL

Mouse Monoclonal CD39/ENTPD1 Antibody (498403) [Janelia Fluor 549]

Ask
View Details
Anti-IL-22RA1 Rabbit pAb
GB11302-50 50 μL

Anti-IL-22RA1 Rabbit pAb

Ask
View Details
Recombinant human CD80 protein, C-His (HEK293), Biotin Conjugated
bs-43750P-Biotin-01 20 µg

Recombinant human CD80 protein, C-His (HEK293), Biotin Conjugated

Ask
View Details
Recombinant human CD80 protein, C-His (HEK293), Biotin Conjugated
bs-43750P-Biotin-02 100 µg

Recombinant human CD80 protein, C-His (HEK293), Biotin Conjugated

Ask
View Details
Recombinant human CD80 protein, C-His (HEK293), Biotin Conjugated
bs-43750P-Biotin-03 500 µg

Recombinant human CD80 protein, C-His (HEK293), Biotin Conjugated

Ask
View Details