OSM Human, 209 a.a
Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa.
Product Specifications
Swiss Prot
P13725
Source
Escherichia Coli.
Buffer
Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1 mg/mL) solution containing 1x PBS pH-7.4.
Storage Conditions
Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6195094-01 0.1 mL
CSPG5 (Chondroitin Sulfate Proteoglycan 5 (neuroglycan C), MGC44034, NGC) (MaxLight 405)
Ask
View Details MBS6195094-02 5x 0.1 mL
CSPG5 (Chondroitin Sulfate Proteoglycan 5 (neuroglycan C), MGC44034, NGC) (MaxLight 405)
Ask
View Details 
