Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Human, 209 a.a

Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa.

Product Specifications

Swiss Prot

P13725

Source

Escherichia Coli.

Buffer

Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1 mg/mL) solution containing 1x PBS pH-7.4.

Storage Conditions

Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MMP1 Human, sf9
32-6846-10 10 µg

MMP1 Human, sf9

Ask
View Details
RGD1566386 Rat shRNA Plasmid (Locus ID 304336)
TR705699 1 Kit

RGD1566386 Rat shRNA Plasmid (Locus ID 304336)

Ask
View Details
Taar9 AAV siRNA Pooled Vector
46041164 1.0 µg

Taar9 AAV siRNA Pooled Vector

Ask
View Details
Lentiviral human HAS3 sgRNA gene knockout kit - Lentiviral human HAS3 sgRNA gene knockout kit (plasmid)
GTR15397022 1 Vial

Lentiviral human HAS3 sgRNA gene knockout kit - Lentiviral human HAS3 sgRNA gene knockout kit (plasmid)

Ask
View Details
Fcrla siRNA Oligos set (Mouse)
20413174 3x 5 nmol

Fcrla siRNA Oligos set (Mouse)

Ask
View Details