Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNS1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1314202 1.0 µg DNA

MNS1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Tmem37 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7396804 1.0 µg DNA

Tmem37 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS2563063-01 0.02 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS2563063-02 0.06 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS2563063-03 0.12 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS2563063-04 0.2 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details