Noggin Mouse
Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .
Product Specifications
Swiss Prot
P97466
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Storage Conditions
Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal IgM Antibody (IM260) [Janelia Fluor 549]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
![OR13C9 Antibody (N-term) [APR12528G]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
![OR13C9 Antibody (N-term) [APR12528G]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)