Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF2/bFGF Antibody , PE
E55A10206 50 Tests

Human FGF2/bFGF Antibody , PE

Sign In for Pricing
View Details
Demcizumab (Anti-DLL4)
A2520-1mg*5 5x 1mg

Demcizumab (Anti-DLL4)

Sign In for Pricing
View Details
MUC17 Protein Vector (Human) (pPM-C-His)
PV102929 500 ng

MUC17 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Ano8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3319806 1.0 µg DNA

Ano8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Ihh Rabbit mAb Antibody
orb3014404 100 µL

Ihh Rabbit mAb Antibody

Sign In for Pricing
View Details
CaV1.3 (CACNA1D) (NM_000720) Human Tagged ORF Clone Lentiviral Particle
RC222854L1V 200 µL

CaV1.3 (CACNA1D) (NM_000720) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details