Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Scrib 3'UTR Lenti-reporter-Luc Vector
43201086 1.0 µg

Scrib 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (MaxLight 405) discontinued
245455-ML405 100 µL

DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (MaxLight 405) discontinued

Ask
View Details
CDH16 (Cadherin 16, Cadherin, KSP, Kidney-specific cadherin)
362487 200 µL

CDH16 (Cadherin 16, Cadherin, KSP, Kidney-specific cadherin)

Ask
View Details
Syntaxin 6 / STX6 (1-234, His-tag) Human Protein
AR51167PU-S 100 µg

Syntaxin 6 / STX6 (1-234, His-tag) Human Protein

Ask
View Details