Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CADPS2 knockout cell line
ABC-KH2277 1 Vial

Human CADPS2 knockout cell line

Sign In for Pricing
View Details
Human Oxidized low-density lipoprotein receptor 1 ELISA Kit
MBS2882260-01 48 Well

Human Oxidized low-density lipoprotein receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Oxidized low-density lipoprotein receptor 1 ELISA Kit
MBS2882260-02 96 Well

Human Oxidized low-density lipoprotein receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Oxidized low-density lipoprotein receptor 1 ELISA Kit
MBS2882260-03 5x 96 Well

Human Oxidized low-density lipoprotein receptor 1 ELISA Kit

Sign In for Pricing
View Details
Human Oxidized low-density lipoprotein receptor 1 ELISA Kit
MBS2882260-04 10x 96 Well

Human Oxidized low-density lipoprotein receptor 1 ELISA Kit

Sign In for Pricing
View Details
1,5-Dichloropentan-3-one
sc-352011A 25 g

1,5-Dichloropentan-3-one

Sign In for Pricing
View Details