Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EMD (EDMD, EMD, EMD, Emerin, Emery Dreifuss muscular dystrophy, STA) discontinued
222411-01 50 µL

EMD (EDMD, EMD, EMD, Emerin, Emery Dreifuss muscular dystrophy, STA) discontinued

Ask
View Details
EMD (EDMD, EMD, EMD, Emerin, Emery Dreifuss muscular dystrophy, STA) discontinued
222411-02 100 µL

EMD (EDMD, EMD, EMD, Emerin, Emery Dreifuss muscular dystrophy, STA) discontinued

Ask
View Details
EMX2 (Empty Spiracles Homeobox 2) (APC)
245720-APC 100 µL

EMX2 (Empty Spiracles Homeobox 2) (APC)

Ask
View Details
Mouse SLC25A25 siRNA
abx933711-01 15 nmol

Mouse SLC25A25 siRNA

Ask
View Details
Mouse SLC25A25 siRNA
abx933711-02 30 nmol

Mouse SLC25A25 siRNA

Ask
View Details
CD11b Monoclonal Antibody, APC-Cy7 Conjugated
bsm-54156R-APC-Cy7 100 µL

CD11b Monoclonal Antibody, APC-Cy7 Conjugated

Ask
View Details