Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Afuresertib (GSK2110183)
C12749-5mg 5 mg

Afuresertib (GSK2110183)

Sign In for Pricing
View Details
PMF1-set siRNA/shRNA/RNAi Lentivector (Human)
37061091 4x 500 ng

PMF1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Ddx19a Mouse qPCR Template Standard (NM_007916)
MK200631 1 Kit

Ddx19a Mouse qPCR Template Standard (NM_007916)

Sign In for Pricing
View Details
SLC7A2 (NM_001008539) Human Tagged ORF Clone Lentiviral Particle
RC210214L4V 200 µL

SLC7A2 (NM_001008539) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Progranulin/PGRN ELISA Kit (Colorimetric)
NBP2-82200 1 Kit

Rat Progranulin/PGRN ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Insulin Rabbit pAb, Pacific Blue conjugated
orb2851125 100 µL

Insulin Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details