Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Mouse

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

Product Specifications

Swiss Prot

P97466

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Storage Conditions

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human MYB qPCR Primer Pair
QH04297S 200 Tests

Human MYB qPCR Primer Pair

Ask
View Details
Mouse Spondin 2 ELISA Kit
MBS087424-01 48 Well

Mouse Spondin 2 ELISA Kit

Ask
View Details
Mouse Spondin 2 ELISA Kit
MBS087424-02 96 Well

Mouse Spondin 2 ELISA Kit

Ask
View Details
Mouse Spondin 2 ELISA Kit
MBS087424-03 5x 96 Well

Mouse Spondin 2 ELISA Kit

Ask
View Details
Mouse Spondin 2 ELISA Kit
MBS087424-04 10x 96 Well

Mouse Spondin 2 ELISA Kit

Ask
View Details
Rno-miR-3571 miRNA Mimic
CMR0618-01 5 nmol

Rno-miR-3571 miRNA Mimic

Ask
View Details