LR3 IGF1 Human
The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.
Storage Conditions
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1277971-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
RIT1 cDNA Clone
Sign In for Pricing
View Details MBS1277971-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock
RIT1 cDNA Clone
Sign In for Pricing
View Details 
K0807107 1.0 µg DNA
FRA9F sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details MBS6310773-01 0.2 mL
IQCJ, CT (IQCJ, IQ domain-containing protein J) (AP)
Sign In for Pricing
View Details MBS6310773-02 5x 0.2 mL
IQCJ, CT (IQCJ, IQ domain-containing protein J) (AP)
Sign In for Pricing
View Details