LR3 IGF1 Human
The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.
Storage Conditions
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Product Datasheet
https://www.omnimabs.com/view/goto.aspx?viewtype=getproductmanual&id=97767
Sequence Similarities
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal INPP4B Antibody [CoraFluor 1]](https://cdn.genprice.uk/genprice/genprice3.png)
