LR3 IGF1 Human
The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
Product Specifications
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.
Storage Conditions
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9330739-01 48 Well
Mouse UDP-GlcNAc:betaGal beta-1, 3-N-acetylglucosaminyltransferase 7, B3GNT7 ELISA Kit
Sign In for Pricing
View Details MBS9330739-02 96 Well
Mouse UDP-GlcNAc:betaGal beta-1, 3-N-acetylglucosaminyltransferase 7, B3GNT7 ELISA Kit
Sign In for Pricing
View Details MBS9330739-03 5x 96 Well
Mouse UDP-GlcNAc:betaGal beta-1, 3-N-acetylglucosaminyltransferase 7, B3GNT7 ELISA Kit
Sign In for Pricing
View Details MBS9330739-04 10x 96 Well
Mouse UDP-GlcNAc:betaGal beta-1, 3-N-acetylglucosaminyltransferase 7, B3GNT7 ELISA Kit
Sign In for Pricing
View Details 
MBS6164016-01 0.1 mL
KISS1 (KiSS-1 Metastasis-Suppressor, KiSS-1, METASTIN, MGC39258) (AP)
Sign In for Pricing
View Details MBS6164016-02 5x 0.1 mL
KISS1 (KiSS-1 Metastasis-Suppressor, KiSS-1, METASTIN, MGC39258) (AP)
Sign In for Pricing
View Details