MIF Human, Active
MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Product Specifications
Swiss Prot
P14174
Source
Escherichia Coli.
Buffer
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Storage Conditions
Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2908845-01 20 µg
Recombinant Vibrio cholerae serotype O1 Lipid A export ATP-binding/permease protein MsbA (msbA)
Sign In for Pricing
View Details orb2908845-02 100 µg
Recombinant Vibrio cholerae serotype O1 Lipid A export ATP-binding/permease protein MsbA (msbA)
Sign In for Pricing
View Details 