Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF Human, Active

MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Product Specifications

Swiss Prot

P14174

Source

Escherichia Coli.

Buffer

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Storage Conditions

Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

INT11 (CPSF3L) (NM_001256462) Human Untagged Clone
SC330434 10 µg

INT11 (CPSF3L) (NM_001256462) Human Untagged Clone

Ask
View Details
SLC19A2 Peptide - C-terminal region
MBS3240960-01 0.1 mg

SLC19A2 Peptide - C-terminal region

Ask
View Details
SLC19A2 Peptide - C-terminal region
MBS3240960-02 5x 0.1 mg

SLC19A2 Peptide - C-terminal region

Ask
View Details
SOD1 Over-expression Lysate Product
GWB-D3C92E 0.1 mg

SOD1 Over-expression Lysate Product

Ask
View Details
Soy PC
TRC-S677805-10G 10 g

Soy PC

Ask
View Details