MIF Human, Active
MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Product Specifications
Swiss Prot
P14174
Source
Escherichia Coli.
Buffer
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Storage Conditions
Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
GTR15262343 1 Vial
Lentiviral mouse Plxna1 shRNA (UAS) - Lentiviral mouse Plxna1 shRNA (UAS, RFP) (25)
Ask
View Details 
A0858-90-ML490 100 µL
ADAM 3 (Cyritestin, Kuzbanian, KUZ, MADM, a Disintegrin and Metalloprotease 3) (MaxLight 490) discontinued
Ask
View Details ![Mouse Monoclonal NGFR/TNFRSF16/p75NTR Antibody (2F1C2) [DyLight 755]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP1-51590IR 0.1 mL
Mouse Monoclonal NGFR/TNFRSF16/p75NTR Antibody (2F1C2) [DyLight 755]
Ask
View Details 