Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF Human, Active

MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Product Specifications

Swiss Prot

P14174

Source

Escherichia Coli.

Buffer

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Storage Conditions

Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Perforin-1 Protein, His, E.coli-200ug
QP6526-ec-200ug 200ug

Recombinant Mouse Perforin-1 Protein, His, E.coli-200ug

Ask
View Details
ADA Buffer 0.2M, pH 6.5
40120011-1 100 mL

ADA Buffer 0.2M, pH 6.5

Ask
View Details
EIF4B Rabbit Polyclonal Antibody
TA364769 100 µL

EIF4B Rabbit Polyclonal Antibody

Ask
View Details
TPH2 Blocking Peptide
33R-4561 100 ug

TPH2 Blocking Peptide

Ask
View Details