Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF Human, Active

MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Product Specifications

Swiss Prot

P14174

Source

Escherichia Coli.

Buffer

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Storage Conditions

Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR59 Rabbit pAb
GB111121-50 50 μL

Anti-WDR59 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit C/D (nuoC), partial
MBS1022501 Inquire

Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit C/D (nuoC), partial

Sign In for Pricing
View Details
1,2,3,4,6-Penta-O-trimethylsilyl-D-mannopyranose
MP09490-01 1000 mg

1,2,3,4,6-Penta-O-trimethylsilyl-D-mannopyranose

Sign In for Pricing
View Details
1,2,3,4,6-Penta-O-trimethylsilyl-D-mannopyranose
MP09490-02 500 mg

1,2,3,4,6-Penta-O-trimethylsilyl-D-mannopyranose

Sign In for Pricing
View Details
1,2,3,4,6-Penta-O-trimethylsilyl-D-mannopyranose
MP09490-03 2000 mg

1,2,3,4,6-Penta-O-trimethylsilyl-D-mannopyranose

Sign In for Pricing
View Details
LDOC1 Antibody / Leucine zipper protein down-regulated in cancer cells
RQ8485 100 µg

LDOC1 Antibody / Leucine zipper protein down-regulated in cancer cells

Sign In for Pricing
View Details