MIF Human His C
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Product Specifications
Swiss Prot
P14174
Source
Escherichia Coli.
Buffer
Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.
Storage Conditions
Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![EGFR (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 14C8]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb5d3/imageurl/am00045pu-n.webp)
AM00045PU-N 100 µg
EGFR (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 14C8]
Sign In for Pricing
View Details 
BNUM1703-50 1x 50 µL
PAX8 (Renal Cell Marker) (PAX8/1491 + PAX8/1492), 1mg/mL
Sign In for Pricing
View Details 
![ESE1 (ELF3) Mouse Monoclonal Antibody [Clone ID: OTI6G6]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9088ba/imageurl/cf809989.webp)
CF809989 100 µg
ESE1 (ELF3) Mouse Monoclonal Antibody [Clone ID: OTI6G6]
Sign In for Pricing
View Details 
LY433227 100 µg
MCT7 (SLC16A6) (NM_001174166) Human Over-expression Lysate
Sign In for Pricing
View Details