MIF Human His C
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Product Specifications
Swiss Prot
P14174
Source
Escherichia Coli.
Buffer
Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.
Storage Conditions
Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP01323PU-N 100 µg
NPY receptor 2 / NPY2R Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
17043-AAT 25 nmoles
IFluor®647-PEG12-dUTP *1 mM in TE Buffer (pH 7.5) *
Sign In for Pricing
View Details ![HIV1 p24 Recombinant Rabbit Monoclonal Antibody [PS01-35] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b7b/imageurl/ha721527.webp)
HA721527 100 µL
HIV1 p24 Recombinant Rabbit Monoclonal Antibody [PS01-35] - BSA and Azide free (Capture)
Sign In for Pricing
View Details