Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF Human His C

MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Product Specifications

Swiss Prot

P14174

Source

Escherichia Coli.

Buffer

Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.

Storage Conditions

Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RHBDL1 shRNA (UAS) - Lentiviral human RHBDL1 shRNA (UAS) plasmid
GTR15113563 1 Vial

Lentiviral human RHBDL1 shRNA (UAS) - Lentiviral human RHBDL1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
LOC689986 Protein Vector (Rat) (pPM-C-HA)
PV279516 500 ng

LOC689986 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit
MBS7205824-01 48 Well

Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit
MBS7205824-02 96 Well

Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit
MBS7205824-03 5x 96 Well

Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit
MBS7205824-04 10x 96 Well

Mouse Alpha-tocopherol transfer protein (TTPA) ELISA Kit

Sign In for Pricing
View Details