MIF Human His C
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Product Specifications
Swiss Prot
P14174
Source
Escherichia Coli.
Buffer
Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.
Storage Conditions
Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1213184 Inquire
Recombinant Salmonella heidelberg Elongation factor 4 (lepA), partial
Sign In for Pricing
View Details K1578405 3x 1.0 µg
OTUD3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
VAng-Lsx9813-1mgEcoli 1 mg (E. coli)
Recombinant Clostridium Kluyveri rpsU Protein (aa 1-58) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Sign In for Pricing
View Details