HGF A Human
HGF-A Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag.
Product Specifications
Swiss Prot
P14210
Source
Escherichia Coli.
Buffer
HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks.
Sequence Similarities
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15298342 1 Vial
Lentiviral mouse Mtbp shRNA (UAS) - Lentiviral mouse Mtbp shRNA (UAS) plasmid
Sign In for Pricing
View Details