Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF A Human

HGF-A Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Buffer

HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Erwinia tasmaniensis ATP synthase subunit c (atpE)
MBS7009192-01 0.02 mg

Recombinant Erwinia tasmaniensis ATP synthase subunit c (atpE)

Ask
View Details
Recombinant Erwinia tasmaniensis ATP synthase subunit c (atpE)
MBS7009192-02 0.1 mg

Recombinant Erwinia tasmaniensis ATP synthase subunit c (atpE)

Ask
View Details
Recombinant Erwinia tasmaniensis ATP synthase subunit c (atpE)
MBS7009192-03 5x 0.1 mg

Recombinant Erwinia tasmaniensis ATP synthase subunit c (atpE)

Ask
View Details
MAG Antibody
A27926-100UG 100 µg

MAG Antibody

Ask
View Details
Anti-CA VI antibody
STJ91943 200 µl

Anti-CA VI antibody

Ask
View Details
Lentiviral mouse Trpm7 shRNA (UAS) - Lentiviral mouse Trpm7 shRNA (UAS) (25)
GTR15219197 1 Vial

Lentiviral mouse Trpm7 shRNA (UAS) - Lentiviral mouse Trpm7 shRNA (UAS) (25)

Ask
View Details