HGF B Human
HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.
Product Specifications
Swiss Prot
P14210
Source
Escherichia Coli.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks.
Sequence Similarities
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
RC225226L3V 200 µL
PPP1R14D (NM_001130143) Human Tagged ORF Clone Lentiviral Particle
Ask
View Details 