Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF B Human

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)
MBS1352966-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)
MBS1352966-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)
MBS1352966-03 0.02 mg (Yeast)

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)
MBS1352966-04 0.1 mg (Yeast)

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)
MBS1352966-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)
MBS1352966-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O6 Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details