Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGF B Human

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

Product Specifications

Swiss Prot

P14210

Source

Escherichia Coli.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.

Sequence Similarities

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS8 Antibody - middle region
OASG06436-100UL 100 µL

RPS8 Antibody - middle region

Sign In for Pricing
View Details
Anti-YTHDF3 Antibody
MBS8308658-01 0.03 mL

Anti-YTHDF3 Antibody

Sign In for Pricing
View Details
Anti-YTHDF3 Antibody
MBS8308658-02 0.05 mL

Anti-YTHDF3 Antibody

Sign In for Pricing
View Details
Anti-YTHDF3 Antibody
MBS8308658-03 0.1 mL

Anti-YTHDF3 Antibody

Sign In for Pricing
View Details
Anti-YTHDF3 Antibody
MBS8308658-04 0.2 mL

Anti-YTHDF3 Antibody

Sign In for Pricing
View Details
Anti-YTHDF3 Antibody
MBS8308658-05 5x 0.2 mL

Anti-YTHDF3 Antibody

Sign In for Pricing
View Details